NMRAL1 anticorps (Middle Region)

N° du produit ABIN631947

Cet anticorps anti-NMRAL1 est un anticorps Polyclonal produit chez le Lapin, détectant NMRAL1 dans WB. Convient pour Humain.

Aperçu rapide pour NMRAL1 anticorps (Middle Region) (ABIN631947)

Antigène: NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NMRAL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NMRAL1 anticorps

Épitope: Middle Region

Specificité: NMRAL1 antibody was raised against the middle region of NMRAL1

Purification: Affinity purified

Immunogène: NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NMRAL1 Blocking Peptide, (ABIN5615011), is also available for use as a blocking control in assays to test for specificity of this NMRAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMRAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NMRAL1

Antigène: NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))

Autre désignation: NMRAL1

Sujet: The function of this protein is binding, oxidoreductase activity and transcription repressor activity.

Poids moléculaire: 33 kDa (MW of target protein)