ANKRD5 anticorps (N-Term)

N° du produit ABIN631952

Détail du produit anti-ANKRD5 anticorps

Antigène: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKRD5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANKRD5 antibody was raised against the N terminal of ANKRD5

Purification: Affinity purified

Immunogène: ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKRD5 Blocking Peptide, catalog no. 33R-6546, is also available for use as a blocking control in assays to test for specificity of this ANKRD5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKRD5

Antigène: ANKRD5 (Ankyrin Repeat Domain 5 (ANKRD5))

Autre désignation: ANKRD5 (ANKRD5 Produits)

Synonymes: anticorps anr5, anticorps MGC146428, anticorps DKFZp469P046, anticorps ANKRD5, anticorps dJ839B4.6, anticorps AV276460, anticorps Ankrd5, anticorps ankyrin repeat and EF-hand domain containing 1 L homeolog, anticorps ankyrin repeat and EF-hand domain containing 1, anticorps ankef1.L, anticorps ankef1, anticorps ANKEF1, anticorps Ankef1

Sujet: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 87 kDa (MW of target protein)