FBP2 anticorps (Middle Region)

N° du produit ABIN631953

Détail du produit anti-FBP2 anticorps

Antigène: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBP2 antibody was raised against the middle region of FBP2

Purification: Affinity purified

Immunogène: FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBP2 Blocking Peptide, catalog no. 33R-10138, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBP2

Antigène: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Autre désignation: FBP2 (FBP2 Produits)

Synonymes: anticorps 6330409F21Rik, anticorps Fbp2, anticorps Fubp2, anticorps Ksrp, anticorps Fbp-1, anticorps Fbp1, anticorps Rae-30, anticorps FBPase, anticorps zgc:101083, anticorps FBP2, anticorps MGC108013, anticorps FBP, anticorps fructose-bisphosphatase 2, anticorps KH-type splicing regulatory protein, anticorps fructose bisphosphatase 2, anticorps fructose-1,6-bisphosphatase 2, anticorps fructose-bisphosphatase 2 L homeolog, anticorps FBP2, anticorps Khsrp, anticorps Fbp2, anticorps fbp2, anticorps fbp2.L

Sujet: FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.

Poids moléculaire: 37 kDa (MW of target protein)