MDH1B anticorps

N° du produit ABIN631954

Cet anticorps Lapin Polyclonal détecte spécifiquement MDH1B dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MDH1B anticorps (ABIN631954)

Antigène: MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDH1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MDH1B anticorps

Purification: Affinity purified

Immunogène: MDH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MDH1B Blocking Peptide, (ABIN936191), is also available for use as a blocking control in assays to test for specificity of this MDH1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MDH1B

Antigène: MDH1B (Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B))

Autre désignation: MDH1B

Sujet: The function of MDH1B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 59 kDa (MW of target protein)