ADH5 anticorps

N° du produit ABIN631955

Détail du produit anti-ADH5 anticorps

Antigène: ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADH5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADH5 Blocking Peptide, catalog no. 33R-4667, is also available for use as a blocking control in assays to test for specificity of this ADH5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADH5

Antigène: ADH5 (Alcohol Dehydrogenase 5 (Class III), chi Polypeptide (ADH5))

Autre désignation: ADH5 (ADH5 Produits)

Synonymes: anticorps ADH2, anticorps ADH-3, anticorps ADHX, anticorps FALDH, anticorps FDH, anticorps GSH-FDH, anticorps GSNOR, anticorps ADH1C, anticorps ADH3, anticorps wu:fb60b11, anticorps Adh-5, anticorps Adh3, anticorps adh-3, anticorps adh3, anticorps adh5, anticorps adhx, anticorps fdh, anticorps gsnor, anticorps ADH4, anticorps ADH5, anticorps alcohol dehydrogenase 1B (class I), beta polypeptide, anticorps alcohol dehydrogenase 5 (class III), chi polypeptide, anticorps alcohol dehydrogenase 5, anticorps alcohol dehydrogenase 5 (class III), chi polypeptide L homeolog, anticorps alcohol dehydrogenase class-3, anticorps ADH1B, anticorps ADH5, anticorps adh5, anticorps Adh5, anticorps adh5.L, anticorps LOC101112223

Sujet: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.

Poids moléculaire: 40 kDa (MW of target protein)