POLR1E anticorps

N° du produit ABIN631957

Cet anticorps Lapin Polyclonal détecte spécifiquement POLR1E dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour POLR1E anticorps (ABIN631957)

Antigène: POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLR1E est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLR1E anticorps

Purification: Affinity purified

Immunogène: POLR1 E antibody was raised using a synthetic peptide corresponding to a region with amino acids SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLR1E Blocking Peptide, (ABIN5615463), is also available for use as a blocking control in assays to test for specificity of this POLR1E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLR1E

Antigène: POLR1E (Polymerase (RNA) I Polypeptide E, 53kDa (POLR1E))

Autre désignation: POLR1E

Sujet: POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

Poids moléculaire: 47 kDa (MW of target protein)