WDR1 anticorps (N-Term)

N° du produit ABIN631958

L’anticorps Lapin Polyclonal anti-WDR1 a été validé pour WB. Il convient pour détecter WDR1 dans des échantillons de Humain.

Aperçu rapide pour WDR1 anticorps (N-Term) (ABIN631958)

Antigène: WDR1 (WD Repeat Domain 1 (WDR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WDR1 anticorps

Épitope: N-Term

Specificité: WDR1 antibody was raised against the N terminal of WDR1

Purification: Affinity purified

Immunogène: WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR1 Blocking Peptide, (ABIN937374), is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR1

Antigène: WDR1 (WD Repeat Domain 1 (WDR1))

Autre désignation: WDR1

Sujet: WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Sensory Perception of Sound