TPD52 anticorps (Middle Region)

N° du produit ABIN631964

L’anticorps Lapin Polyclonal anti-TPD52 a été validé pour WB. Il convient pour détecter TPD52 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TPD52 anticorps (Middle Region) (ABIN631964)

Antigène: TPD52 (Tumor Protein D52 (TPD52))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPD52 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TPD52 anticorps

Épitope: Middle Region

Specificité: TPD52 antibody was raised against the middle region of TPD52

Purification: Affinity purified

Immunogène: TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPD52 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this TPD52 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPD52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPD52

Antigène: TPD52 (Tumor Protein D52 (TPD52))

Autre désignation: TPD52

Sujet: TPD52 belongs to the TPD52 family. Its exact function remains unknown.

Poids moléculaire: 24 kDa (MW of target protein)