SPICE1 anticorps (N-Term)

N° du produit ABIN631969

Détail du produit anti-SPICE1 anticorps

Antigène: SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPICE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC52 antibody was raised against the N terminal of CCDC52

Purification: Affinity purified

Immunogène: CCDC52 antibody was raised using the N terminal of CCDC52 corresponding to a region with amino acids TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC52 Blocking Peptide, catalog no. 33R-9371, is also available for use as a blocking control in assays to test for specificity of this CCDC52 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC52 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPICE1

Antigène: SPICE1 (Spindle and Centriole Associated Protein 1 (SPICE1))

Autre désignation: CCDC52 (SPICE1 Produits)

Synonymes: anticorps CCDC52, anticorps ccdc52, anticorps zgc:101558, anticorps SPICE, anticorps Ccdc52, anticorps D16Ertd480e, anticorps RGD1310729, anticorps spindle and centriole associated protein 1, anticorps spindle and centriole associated protein 1 L homeolog, anticorps SPICE1, anticorps spice1, anticorps Spice1, anticorps spice1.L

Sujet: The specific function of CCDC52 is not yet known.

Poids moléculaire: 96 kDa (MW of target protein)