FSIP1 anticorps (Middle Region)

N° du produit ABIN631970

L’anticorps Lapin Polyclonal anti-FSIP1 a été validé pour WB. Il convient pour détecter FSIP1 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour FSIP1 anticorps (Middle Region) (ABIN631970)

Antigène: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FSIP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FSIP1 anticorps

Épitope: Middle Region

Specificité: FSIP1 antibody was raised against the middle region of FSIP1

Purification: Affinity purified

Immunogène: FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FSIP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FSIP1

Antigène: FSIP1 (Fibrous Sheath Interacting Protein 1 (FSIP1))

Autre désignation: FSIP1

Sujet: The function of FSIP1 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 66 kDa (MW of target protein)