ZADH2 anticorps (N-Term)

N° du produit ABIN631977

Détail du produit anti-ZADH2 anticorps

Antigène: ZADH2 (Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZADH2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZADH2 antibody was raised against the N terminal of ZADH2

Purification: Affinity purified

Immunogène: ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZADH2 Blocking Peptide, catalog no. 33R-3114, is also available for use as a blocking control in assays to test for specificity of this ZADH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZADH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZADH2

Antigène: ZADH2 (Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2))

Autre désignation: ZADH2 (ZADH2 Produits)

Synonymes: anticorps ZADH2, anticorps C530046K17Rik, anticorps zinc binding alcohol dehydrogenase domain containing 2, anticorps zinc binding alcohol dehydrogenase, domain containing 2, anticorps ZADH2, anticorps Zadh2

Sujet: The function of ZADH2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 43 kDa (MW of target protein)