NHLRC2 anticorps (N-Term)

N° du produit ABIN631979

L’anticorps Lapin Polyclonal anti-NHLRC2 a été validé pour WB. Il convient pour détecter NHLRC2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour NHLRC2 anticorps (N-Term) (ABIN631979)

Antigène: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NHLRC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NHLRC2 anticorps

Épitope: N-Term

Specificité: NHLRC2 antibody was raised against the N terminal of NHLRC2

Purification: Affinity purified

Immunogène: NHLRC2 antibody was raised using the N terminal of NHLRC2 corresponding to a region with amino acids YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NHLRC2 Blocking Peptide, (ABIN936212), is also available for use as a blocking control in assays to test for specificity of this NHLRC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHLRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NHLRC2

Antigène: NHLRC2 (NHL Repeat Containing 2 (NHLRC2))

Autre désignation: NHLRC2

Sujet: The function of NHLRC2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 79 kDa (MW of target protein)