RSPH10B anticorps

N° du produit ABIN631980

Détail du produit anti-RSPH10B anticorps

Antigène: RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSPH10B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RSPH10 B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSPH10B Blocking Peptide, catalog no. 33R-2414, is also available for use as a blocking control in assays to test for specificity of this RSPH10B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSPH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSPH10B

Antigène: RSPH10B (Radial Spoke Head 10 Homolog B (RSPH10B))

Autre désignation: RSPH10B (RSPH10B Produits)

Synonymes: anticorps RSPH10B2, anticorps RGD1311893, anticorps radial spoke head 10 homolog B, anticorps radial spoke head 10 homolog B (Chlamydomonas), anticorps RSPH10B, anticorps Rsph10b

Sujet: The function of RSPH10B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 96 kDa (MW of target protein)