Syntaxin 19 anticorps (N-Term)

N° du produit ABIN631981

Cet anticorps Lapin Polyclonal détecte spécifiquement Syntaxin 19 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Syntaxin 19 anticorps (N-Term) (ABIN631981)

Antigène: Syntaxin 19 (STX19)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Syntaxin 19 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Syntaxin 19 anticorps

Épitope: N-Term

Specificité: Syntaxin 19 antibody was raised against the N terminal of STX19

Purification: Affinity purified

Immunogène: Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Syntaxin 19 Blocking Peptide, (ABIN5616482), is also available for use as a blocking control in assays to test for specificity of this Syntaxin 19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STX19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Syntaxin 19

Antigène: Syntaxin 19 (STX19)

Autre désignation: Syntaxin 19

Sujet: The function of Syntaxin 19 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 34 kDa (MW of target protein)