MTHFD2L anticorps

N° du produit ABIN631982

L’anticorps anti-MTHFD2L Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de MTHFD2L dans des échantillons provenant de Humain, Souris et Rat. }

Aperçu rapide pour MTHFD2L anticorps (ABIN631982)

Antigène: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTHFD2L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MTHFD2L anticorps

Purification: Affinity purified

Immunogène: MTHFD2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTHFD2L Blocking Peptide, (ABIN5614868), is also available for use as a blocking control in assays to test for specificity of this MTHFD2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTHFD2L

Antigène: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Autre désignation: MTHFD2L

Sujet: The function of MTHFD2L protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 37 kDa (MW of target protein)