MTHFD2L anticorps

N° du produit ABIN631982

Détail du produit anti-MTHFD2L anticorps

Antigène: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTHFD2L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MTHFD2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTHFD2L Blocking Peptide, catalog no. 33R-9087, is also available for use as a blocking control in assays to test for specificity of this MTHFD2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTHFD2L

Antigène: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2-Like (MTHFD2L))

Autre désignation: MTHFD2L (MTHFD2L Produits)

Synonymes: anticorps wu:fi14c12, anticorps zgc:63479, anticorps 1110019K23Rik, anticorps C630010D07Rik, anticorps RGD1310879, anticorps methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like, anticorps methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like, anticorps MTHFD2L, anticorps mthfd2l, anticorps Mthfd2l

Sujet: The function of MTHFD2L protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 37 kDa (MW of target protein)