PRR16 anticorps (Middle Region)

N° du produit ABIN631986

Cet anticorps anti-PRR16 est un anticorps Lapin Polyclonal détectant PRR16 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PRR16 anticorps (Middle Region) (ABIN631986)

Antigène: PRR16 (Proline Rich 16 (PRR16))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRR16 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRR16 anticorps

Épitope: Middle Region

Specificité: PRR16 antibody was raised against the middle region of PRR16

Purification: Affinity purified

Immunogène: PRR16 antibody was raised using the middle region of PRR16 corresponding to a region with amino acids RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRR16 Blocking Peptide, (ABIN5615592), is also available for use as a blocking control in assays to test for specificity of this PRR16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRR16

Antigène: PRR16 (Proline Rich 16 (PRR16))

Autre désignation: PRR16

Sujet: The function of PRR16 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)