LRRC49 anticorps (N-Term)

N° du produit ABIN631987

Cet anticorps Lapin Polyclonal détecte spécifiquement LRRC49 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour LRRC49 anticorps (N-Term) (ABIN631987)

Antigène: LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC49 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRC49 anticorps

Épitope: N-Term

Specificité: LRRC49 antibody was raised against the N terminal of LRRC49

Purification: Affinity purified

Immunogène: LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC49 Blocking Peptide, (ABIN940089), is also available for use as a blocking control in assays to test for specificity of this LRRC49 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC49

Antigène: LRRC49 (Leucine Rich Repeat Containing 49 (LRRC49))

Autre désignation: LRRC49

Sujet: The function of LRRC49 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 79 kDa (MW of target protein)