BRIX1 anticorps (Middle Region)

N° du produit ABIN631990

Cet anticorps Lapin Polyclonal détecte spécifiquement BRIX1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour BRIX1 anticorps (Middle Region) (ABIN631990)

Antigène: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRIX1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BRIX1 anticorps

Épitope: Middle Region

Specificité: BXDC2 antibody was raised against the middle region of Bxdc2

Purification: Affinity purified

Immunogène: BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BXDC2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRIX1

Antigène: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Autre désignation: BXDC2

Sujet: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Poids moléculaire: 41 kDa (MW of target protein)