BRIX1 anticorps (Middle Region)

N° du produit ABIN631990

Détail du produit anti-BRIX1 anticorps

Antigène: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRIX1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BXDC2 antibody was raised against the middle region of Bxdc2

Purification: Affinity purified

Immunogène: BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BXDC2 Blocking Peptide, catalog no. 33R-1351, is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRIX1

Antigène: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Autre désignation: BXDC2 (BRIX1 Produits)

Synonymes: anticorps BXDC2, anticorps brix, anticorps bxdc2, anticorps BRIX, anticorps 1110064N10Rik, anticorps Bxdc2, anticorps C76935, anticorps RGD1308508, anticorps BRX1, biogenesis of ribosomes, anticorps BRX1, biogenesis of ribosomes S homeolog, anticorps BRIX1, anticorps brix1.S, anticorps Brix1

Sujet: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Poids moléculaire: 41 kDa (MW of target protein)