BRIX1 anticorps (Middle Region)
-
- Antigène Voir toutes BRIX1 Anticorps
- BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BRIX1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BXDC2 antibody was raised against the middle region of Bxdc2
- Purification
- Affinity purified
- Immunogène
- BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA
- Top Product
- Discover our top product BRIX1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BXDC2 Blocking Peptide, catalog no. 33R-1351, is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))
- Autre désignation
- BXDC2 (BRIX1 Produits)
- Synonymes
- anticorps BXDC2, anticorps brix, anticorps bxdc2, anticorps BRIX, anticorps 1110064N10Rik, anticorps Bxdc2, anticorps C76935, anticorps RGD1308508, anticorps BRX1, biogenesis of ribosomes, anticorps BRX1, biogenesis of ribosomes S homeolog, anticorps BRIX1, anticorps brix1.S, anticorps Brix1
- Sujet
- BXDC2 is required for biogenesis of the 60S ribosomal subunit.
- Poids moléculaire
- 41 kDa (MW of target protein)
-