EXD3 anticorps (N-Term)

N° du produit ABIN631991

L’anticorps anti-EXD3 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de EXD3 dans des échantillons provenant de Humain. }

Aperçu rapide pour EXD3 anticorps (N-Term) (ABIN631991)

Antigène: EXD3 (Exonuclease 3'-5' Domain Containing 3 (EXD3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXD3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EXD3 anticorps

Épitope: N-Term

Specificité: FLJ20433 antibody was raised against the N terminal of FLJ20433

Purification: Affinity purified

Immunogène: FLJ20433 antibody was raised using the N terminal of FLJ20433 corresponding to a region with amino acids MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ20433 Blocking Peptide, (ABIN5613606), is also available for use as a blocking control in assays to test for specificity of this FLJ20433 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20433 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXD3

Antigène: EXD3 (Exonuclease 3'-5' Domain Containing 3 (EXD3))

Sujet: The specific function of FLJ20433 is not yet known.

Poids moléculaire: 83 kDa (MW of target protein)