FBXO39 anticorps (Middle Region)

N° du produit ABIN632004

Détail du produit anti-FBXO39 anticorps

Antigène: FBXO39 (F-Box Protein 39 (FBXO39))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO39 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO39 antibody was raised against the middle region of FBXO39

Purification: Affinity purified

Immunogène: FBXO39 antibody was raised using the middle region of FBXO39 corresponding to a region with amino acids RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO39 Blocking Peptide, catalog no. 33R-8114, is also available for use as a blocking control in assays to test for specificity of this FBXO39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO39

Antigène: FBXO39 (F-Box Protein 39 (FBXO39))

Autre désignation: FBXO39 (FBXO39 Produits)

Synonymes: anticorps Fbx39, anticorps 1700010H23Rik, anticorps F-box protein 39, anticorps FBXO39, anticorps Fbxo39

Sujet: FBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 53 kDa (MW of target protein)