Dystrobrevin beta anticorps (C-Term)

N° du produit ABIN632005

Détail du produit anti-Dystrobrevin beta anticorps

Antigène: Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Dystrobrevin beta est non-conjugé

Application: Western Blotting (WB)

Specificité: DTNB antibody was raised against the C terminal of DTNB

Purification: Affinity purified

Immunogène: DTNB antibody was raised using the C terminal of DTNB corresponding to a region with amino acids ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DTNB Blocking Peptide, catalog no. 33R-1524, is also available for use as a blocking control in assays to test for specificity of this DTNB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTNB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Dystrobrevin beta

Antigène: Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))

Autre désignation: DTNB (DTNB Produits)

Synonymes: anticorps DTNB, anticorps bdtn, anticorps btnb, anticorps dtnb, anticorps GDTN, anticorps dtng, anticorps gtnb, anticorps wu:fc61h11, anticorps dystrobrevin beta, anticorps dystrobrevin, beta b, anticorps dystrobrevin, beta, anticorps dystrobrevin, beta a, anticorps DTNB, anticorps dtnbb, anticorps Dtnb, anticorps dtnba, anticorps dtnb

Sujet: DTNB is dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin.

Poids moléculaire: 64 kDa (MW of target protein)