UCK2 anticorps (N-Term)

N° du produit ABIN632007

Cet anticorps anti-UCK2 est un anticorps Lapin Polyclonal détectant UCK2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour UCK2 anticorps (N-Term) (ABIN632007)

Antigène: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UCK2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UCK2 anticorps

Épitope: N-Term

Specificité: UCK2 antibody was raised against the N terminal of UCK2

Purification: Affinity purified

Immunogène: UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UCK2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UCK2

Antigène: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Autre désignation: UCK2

Sujet: UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Feeding Behaviour