FAM29A anticorps (Middle Region)

N° du produit ABIN632011

Détail du produit anti-FAM29A anticorps

Antigène: FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM29A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM29 A antibody was raised against the middle region of Fam29

Purification: Affinity purified

Immunogène: FAM29 A antibody was raised using the middle region of Fam29 corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM29A Blocking Peptide, catalog no. 33R-8198, is also available for use as a blocking control in assays to test for specificity of this FAM29A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM29A

Antigène: FAM29A (HAUS6) (HAUS Augmin-Like Complex, Subunit 6 (HAUS6))

Autre désignation: FAM29A (HAUS6 Produits)

Synonymes: anticorps Dgt6, anticorps FAM29A, anticorps fam29a, anticorps wu:fd21a02, anticorps zgc:153242, anticorps family with sequence similarity 29, member A, anticorps HAUS augmin like complex subunit 6, anticorps HAUS augmin-like complex, subunit 6, anticorps Fam29a, anticorps HAUS6, anticorps haus6

Sujet: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Poids moléculaire: 108 kDa (MW of target protein)