Pellino 1 anticorps

N° du produit ABIN632023

Détail du produit anti-Pellino 1 anticorps

Antigène: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Pellino 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PELI1 Blocking Peptide, catalog no. 33R-2740, is also available for use as a blocking control in assays to test for specificity of this PELI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PELI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Pellino 1

Antigène: Pellino 1 (PELI1) (Pellino E3 Ubiquitin Protein Ligase 1 (PELI1))

Autre désignation: PELI1 (PELI1 Produits)

Synonymes: anticorps 2810468L03Rik, anticorps A930031K15Rik, anticorps AA409794, anticorps AI586297, anticorps D11Ertd676e, anticorps peli1, anticorps peli1.L, anticorps pellino1, anticorps xpellino1, anticorps wu:fd12d01, anticorps zgc:153297, anticorps pellino E3 ubiquitin protein ligase 1, anticorps pellino 1, anticorps pellino E3 ubiquitin protein ligase 1 S homeolog, anticorps pellino E3 ubiquitin protein ligase 1b, anticorps PELI1, anticorps Peli1, anticorps peli1.S, anticorps peli1b

Sujet: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades