RAB40C anticorps (N-Term)

N° du produit ABIN632024

Détail du produit anti-RAB40C anticorps

Antigène: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB40C est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB40 C antibody was raised against the N terminal of RAB40

Purification: Affinity purified

Immunogène: RAB40 C antibody was raised using the N terminal of RAB40 corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB40C Blocking Peptide, catalog no. 33R-7497, is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB40C

Antigène: RAB40C (RAB40C, Member RAS Oncogene Family (RAB40C))

Autre désignation: RAB40C (RAB40C Produits)

Synonymes: anticorps RAB40C, anticorps cb453, anticorps wu:fk50d06, anticorps zgc:136966, anticorps RARL, anticorps RASL8C, anticorps RAR3, anticorps Rab40c, member RAS oncogene family, anticorps RAB40C, member RAS oncogene family, anticorps RAB40c, member RAS oncogene family, anticorps Rab40C, member RAS oncogene family, anticorps Rab40c, anticorps RAB40C, anticorps rab40c

Sujet: RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Poids moléculaire: 31 kDa (MW of target protein)