TCP11 anticorps

N° du produit ABIN632031

Détail du produit anti-TCP11 anticorps

Antigène: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCP11 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCP11 Blocking Peptide, catalog no. 33R-2078, is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCP11

Antigène: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Autre désignation: TCP11 (TCP11 Produits)

Synonymes: anticorps D6S230E, anticorps FPPR, anticorps D17Ken1, anticorps Tcp-11, anticorps t-complex 11, anticorps t-complex protein 11, anticorps Tcp11, anticorps TCP11

Sujet: TCP11 may play an important role in sperm function and fertility.

Poids moléculaire: 49 kDa (MW of target protein)