FAM13C anticorps (N-Term)

N° du produit ABIN632036

L’anticorps anti-FAM13C Polyclonal Lapin est utilisé pour la détection de FAM13C dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour FAM13C anticorps (N-Term) (ABIN632036)

Antigène: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM13C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM13C anticorps

Épitope: N-Term

Specificité: FAM13 C1 antibody was raised against the N terminal of FAM13 1

Purification: Affinity purified

Immunogène: FAM13 C1 antibody was raised using the N terminal of FAM13 1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM13C1 Blocking Peptide, (ABIN5613472), is also available for use as a blocking control in assays to test for specificity of this FAM13C1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM13C

Antigène: FAM13C (Family with Sequence Similarity 13, Member C (FAM13C))

Autre désignation: FAM13C1

Sujet: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Poids moléculaire: 55 kDa (MW of target protein)