DCAF4 anticorps (Middle Region)

N° du produit ABIN632039

L’anticorps anti-DCAF4 Polyclonal Lapin est utilisé pour la détection de DCAF4 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour DCAF4 anticorps (Middle Region) (ABIN632039)

Antigène: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCAF4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DCAF4 anticorps

Épitope: Middle Region

Specificité: WDR21 A antibody was raised against the middle region of WDR21

Purification: Affinity purified

Immunogène: WDR21 A antibody was raised using the middle region of WDR21 corresponding to a region with amino acids ARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR21A Blocking Peptide, (ABIN936869), is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCAF4

Antigène: DCAF4 (DDB1 and CUL4 Associated Factor 4 (DCAF4))

Autre désignation: WDR21A

Sujet: This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Poids moléculaire: 56 kDa (MW of target protein)