Phosphoglucomutase 1 anticorps (Middle Region)

N° du produit ABIN632042

L’anticorps Lapin Polyclonal anti-Phosphoglucomutase 1 a été validé pour WB. Il convient pour détecter Phosphoglucomutase 1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Phosphoglucomutase 1 anticorps (Middle Region) (ABIN632042)

Antigène: Phosphoglucomutase 1 (PGM1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Phosphoglucomutase 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Phosphoglucomutase 1 anticorps

Épitope: Middle Region

Specificité: PGM1 antibody was raised against the middle region of PGM1

Purification: Affinity purified

Immunogène: PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGM1 Blocking Peptide, (ABIN936945), is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Phosphoglucomutase 1

Antigène: Phosphoglucomutase 1 (PGM1)

Autre désignation: PGM1

Sujet: PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process