EFHA2 anticorps (N-Term)

N° du produit ABIN632049

Détail du produit anti-EFHA2 anticorps

Antigène: EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EFHA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: EFHA2 antibody was raised against the N terminal of EFHA2

Purification: Affinity purified

Immunogène: EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFHA2 Blocking Peptide, catalog no. 33R-9171, is also available for use as a blocking control in assays to test for specificity of this EFHA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFHA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EFHA2

Antigène: EFHA2 (MICU3) (Mitochondrial Calcium Uptake Family, Member 3 (MICU3))

Autre désignation: EFHA2 (MICU3 Produits)

Synonymes: anticorps EFHA2, anticorps mitochondrial calcium uptake family member 3, anticorps MICU3

Sujet: The function of EFHA protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 61 kDa (MW of target protein)