VPS53 anticorps

N° du produit ABIN632054

L’anticorps anti-VPS53 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de VPS53 dans des échantillons provenant de Humain. }

Aperçu rapide pour VPS53 anticorps (ABIN632054)

Antigène: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS53 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VPS53 anticorps

Purification: Affinity purified

Immunogène: VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS53 Blocking Peptide, (ABIN5616982), is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS53

Antigène: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Autre désignation: VPS53

Sujet: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Poids moléculaire: 92 kDa (MW of target protein)