LDHD anticorps (Middle Region)

N° du produit ABIN632075

L’anticorps anti-LDHD Polyclonal Lapin est utilisé pour la détection de LDHD dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour LDHD anticorps (Middle Region) (ABIN632075)

Antigène: LDHD (Lactate Dehydrogenase D (LDHD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LDHD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LDHD anticorps

Épitope: Middle Region

Specificité: LDHD antibody was raised against the middle region of LDHD

Purification: Affinity purified

Immunogène: LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LDHD Blocking Peptide, (ABIN5614435), is also available for use as a blocking control in assays to test for specificity of this LDHD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LDHD

Antigène: LDHD (Lactate Dehydrogenase D (LDHD))

Autre désignation: LDHD

Sujet: The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process