C9orf153 anticorps (Middle Region)

N° du produit ABIN632076

Cet anticorps anti-C9orf153 est un anticorps Lapin Polyclonal détectant C9orf153 dans WB. Adapté pour Humain.

Aperçu rapide pour C9orf153 anticorps (Middle Region) (ABIN632076)

Antigène: C9orf153 (Chromosome 9 Open Reading Frame 153 (C9orf153))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C9orf153 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C9orf153 anticorps

Épitope: Middle Region

Specificité: C9 ORF153 antibody was raised against the middle region of C9 rf153

Purification: Affinity purified

Immunogène: C9 ORF153 antibody was raised using the middle region of C9 rf153 corresponding to a region with amino acids NEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF153 Blocking Peptide, (ABIN5612547), is also available for use as a blocking control in assays to test for specificity of this C9ORF153 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF153 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C9orf153

Antigène: C9orf153 (Chromosome 9 Open Reading Frame 153 (C9orf153))

Autre désignation: C9ORF153

Sujet: The function of C9orf153 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 29 kDa (MW of target protein)