TPRG1 anticorps (N-Term)

N° du produit ABIN632078

L’anticorps Lapin Polyclonal anti-TPRG1 a été validé pour WB. Il convient pour détecter TPRG1 dans des échantillons de Humain.

Aperçu rapide pour TPRG1 anticorps (N-Term) (ABIN632078)

Antigène: TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPRG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TPRG1 anticorps

Épitope: N-Term

Specificité: FAM79 B antibody was raised against the N terminal Of Fam79

Purification: Affinity purified

Immunogène: FAM79 B antibody was raised using the N terminal Of Fam79 corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM79B Blocking Peptide, (ABIN937494), is also available for use as a blocking control in assays to test for specificity of this FAM79B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPRG1

Antigène: TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))

Autre désignation: FAM79B

Sujet: The function of FAM79 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)