TPRG1 anticorps (N-Term)

N° du produit ABIN632078

Détail du produit anti-TPRG1 anticorps

Antigène: TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPRG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM79 B antibody was raised against the N terminal Of Fam79

Purification: Affinity purified

Immunogène: FAM79 B antibody was raised using the N terminal Of Fam79 corresponding to a region with amino acids DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM79B Blocking Peptide, catalog no. 33R-2108, is also available for use as a blocking control in assays to test for specificity of this FAM79B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPRG1

Antigène: TPRG1 (Tumor Protein P63 Regulated 1 (TPRG1))

Autre désignation: FAM79B (TPRG1 Produits)

Synonymes: anticorps Tprg, anticorps Svap30, anticorps RGD1306226, anticorps MGC68514, anticorps MGC162933, anticorps zgc:162933, anticorps 5430420C16Rik, anticorps Tprg1, anticorps FAM79B, anticorps tumor protein p63 regulated 1, anticorps tumor protein p63 regulated 1 L homeolog, anticorps transformation related protein 63 regulated, anticorps Tprg1, anticorps tprg1.L, anticorps TPRG1, anticorps tprg1, anticorps Tprg

Sujet: The function of FAM79 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)