C12orf4 anticorps (N-Term)

N° du produit ABIN632079

Cet anticorps anti-C12orf4 est un anticorps Lapin Polyclonal détectant C12orf4 dans WB. Adapté pour Humain.

Aperçu rapide pour C12orf4 anticorps (N-Term) (ABIN632079)

Antigène: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12orf4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C12orf4 anticorps

Épitope: N-Term

Specificité: C12 ORF4 antibody was raised against the N terminal Of C12 rf4

Purification: Affinity purified

Immunogène: C12 ORF4 antibody was raised using the N terminal Of C12 rf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF4 Blocking Peptide, (ABIN937776), is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12orf4

Antigène: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Autre désignation: C12ORF4

Sujet: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 64 kDa (MW of target protein)