C12orf4 anticorps (N-Term)

N° du produit ABIN632079

Détail du produit anti-C12orf4 anticorps

Antigène: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12orf4 est non-conjugé

Application: Western Blotting (WB)

Specificité: C12 ORF4 antibody was raised against the N terminal Of C12 rf4

Purification: Affinity purified

Immunogène: C12 ORF4 antibody was raised using the N terminal Of C12 rf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF4 Blocking Peptide, catalog no. 33R-2390, is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12orf4

Antigène: C12orf4 (Chromosome 12 Open Reading Frame 4 (C12orf4))

Autre désignation: C12ORF4 (C12orf4 Produits)

Synonymes: anticorps MGC53313, anticorps C12orf4, anticorps MGC79726, anticorps chromosome 12 open reading frame 4 L homeolog, anticorps chromosome 1 open reading frame, human C12orf4, anticorps chromosome 12 open reading frame 4, anticorps chromosome 11 open reading frame, human C12orf4, anticorps chromosome 12 open reading frame, human C12orf4, anticorps DNA segment, Chr 6, Wayne State University 163, expressed, anticorps c12orf4.L, anticorps C1H12ORF4, anticorps c12orf4, anticorps C11H12orf4, anticorps C12H12orf4, anticorps C12orf4, anticorps D6Wsu163e

Sujet: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 64 kDa (MW of target protein)