FAM54A anticorps (Middle Region)

N° du produit ABIN632084

Détail du produit anti-FAM54A anticorps

Antigène: FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM54A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM54 A antibody was raised against the middle region of FAM54

Purification: Affinity purified

Immunogène: FAM54 A antibody was raised using the middle region of FAM54 corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM54A Blocking Peptide, catalog no. 33R-6748, is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM54A

Antigène: FAM54A (Family with Sequence Similarity 54, Member A (FAM54A))

Autre désignation: FAM54A (FAM54A Produits)

Synonymes: anticorps FAM54A, anticorps DUFD1, anticorps 2610016C23Rik, anticorps 4933412C16Rik, anticorps Dufd1, anticorps Fam54a, anticorps mitochondrial fission regulator 2, anticorps MTFR2, anticorps Mtfr2

Sujet: FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.

Poids moléculaire: 43 kDa (MW of target protein)