SPACA7 anticorps (Middle Region)

N° du produit ABIN632089

Détail du produit anti-SPACA7 anticorps

Antigène: SPACA7 (C13orf28) (Chromosome 13 Open Reading Frame 28 (C13orf28))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPACA7 est non-conjugé

Application: Western Blotting (WB)

Specificité: C13 ORF28 antibody was raised against the middle region of C13 rf28

Purification: Affinity purified

Immunogène: C13 ORF28 antibody was raised using the middle region of C13 rf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C13ORF28 Blocking Peptide, catalog no. 33R-7105, is also available for use as a blocking control in assays to test for specificity of this C13ORF28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPACA7

Antigène: SPACA7 (C13orf28) (Chromosome 13 Open Reading Frame 28 (C13orf28))

Autre désignation: C13ORF28 (C13orf28 Produits)

Synonymes: anticorps C13orf28, anticorps 1700094C09Rik, anticorps sperm acrosome associated 7, anticorps SPACA7, anticorps Spaca7

Sujet: The function of Chromosome 13 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 21 kDa (MW of target protein)