ACTR3B anticorps

N° du produit ABIN632090

L’anticorps anti-ACTR3B Polyclonal Lapin est utilisé pour la détection de ACTR3B dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ACTR3B anticorps (ABIN632090)

Antigène: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR3B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACTR3B anticorps

Purification: Affinity purified

Immunogène: ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR3B Blocking Peptide, (ABIN937372), is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR3B

Antigène: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Autre désignation: ACTR3B

Sujet: ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization