CNN1 anticorps (N-Term)

N° du produit ABIN632093

L’anticorps Lapin Polyclonal anti-CNN1 a été validé pour WB. Il convient pour détecter CNN1 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour CNN1 anticorps (N-Term) (ABIN632093)

Antigène: CNN1 (Calponin 1 (CNN1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CNN1 anticorps

Épitope: N-Term

Specificité: Calponin 1 antibody was raised against the N terminal of CNN1

Purification: Affinity purified

Immunogène: Calponin 1 antibody was raised using the N terminal of CNN1 corresponding to a region with amino acids MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calponin 1 Blocking Peptide, (ABIN5612587), is also available for use as a blocking control in assays to test for specificity of this Calponin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNN1

Antigène: CNN1 (Calponin 1 (CNN1))

Autre désignation: Calponin 1

Sujet: CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.

Poids moléculaire: 33 kDa (MW of target protein)