MDP1 anticorps (N-Term)

N° du produit ABIN632094

Cet anticorps anti-MDP1 est un anticorps Lapin Polyclonal détectant MDP1 dans WB. Adapté pour Humain.

Aperçu rapide pour MDP1 anticorps (N-Term) (ABIN632094)

Antigène: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MDP1 anticorps

Épitope: N-Term

Specificité: MDP1 antibody was raised against the N terminal Of Mdp-1

Purification: Affinity purified

Immunogène: MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MDP1 Blocking Peptide, (ABIN5614714), is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDP-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MDP1

Antigène: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Autre désignation: MDP1

Sujet: MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Poids moléculaire: 20 kDa (MW of target protein)