ASXL2 anticorps

N° du produit ABIN632099

L’anticorps anti-ASXL2 Polyclonal Lapin est utilisé pour la détection de ASXL2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour ASXL2 anticorps (ABIN632099)

Antigène: ASXL2 (Additional Sex Combs Like 2 (ASXL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASXL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ASXL2 anticorps

Purification: Affinity purified

Immunogène: ASXL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEAPVSWEKRPRVTENRQHQQPFQVSPQPFLNRGDRIQVRKVPPLKIPVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASXL2 Blocking Peptide, (ABIN937723), is also available for use as a blocking control in assays to test for specificity of this ASXL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASXL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASXL2

Antigène: ASXL2 (Additional Sex Combs Like 2 (ASXL2))

Autre désignation: ASXL2

Sujet: ASXL2 is a human homolog of the Drosophila asx gene. Drosophila asx is an enhancer of trithorax and polycomb gene that encodes a chromatin protein with dual functions in transcriptional activation and silencing.

Poids moléculaire: 154 kDa (MW of target protein)

Pathways: Positive Regulation of fat Cell Differentiation