Acylglycerol Kinase anticorps (N-Term)

N° du produit ABIN632105

L’anticorps Lapin Polyclonal anti-Acylglycerol Kinase a été validé pour WB. Il convient pour détecter Acylglycerol Kinase dans des échantillons de Humain.

Aperçu rapide pour Acylglycerol Kinase anticorps (N-Term) (ABIN632105)

Antigène: Acylglycerol Kinase (AGK)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Acylglycerol Kinase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Acylglycerol Kinase anticorps

Épitope: N-Term

Specificité: AGK antibody was raised against the N terminal of AGK

Purification: Affinity purified

Immunogène: AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGK Blocking Peptide, (ABIN939868), is also available for use as a blocking control in assays to test for specificity of this AGK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Acylglycerol Kinase

Antigène: Acylglycerol Kinase (AGK)

Autre désignation: AGK

Sujet: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Poids moléculaire: 47 kDa (MW of target protein)