THG1L anticorps

N° du produit ABIN632108

Détail du produit anti-THG1L anticorps

Antigène: THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THG1L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: THG1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THG1L Blocking Peptide, catalog no. 33R-1871, is also available for use as a blocking control in assays to test for specificity of this THG1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THG1L

Antigène: THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))

Autre désignation: THG1L (THG1L Produits)

Synonymes: anticorps ICF45, anticorps IHG-1, anticorps 1700121M19Rik, anticorps 5730409G07Rik, anticorps AA387658, anticorps tRNA-histidine guanylyltransferase 1 like, anticorps tRNA-histidine guanylyltransferase 1-like (S. cerevisiae), anticorps tRNA-histidine guanylyltransferase 1-like, anticorps THG1L, anticorps Thg1l

Sujet: THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.

Poids moléculaire: 35 kDa (MW of target protein)