THG1L anticorps

N° du produit ABIN632108

L’anticorps anti-THG1L Polyclonal Lapin est utilisé pour la détection de THG1L dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour THG1L anticorps (ABIN632108)

Antigène: THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THG1L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-THG1L anticorps

Purification: Affinity purified

Immunogène: THG1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THG1L Blocking Peptide, (ABIN937257), is also available for use as a blocking control in assays to test for specificity of this THG1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THG1L

Antigène: THG1L (tRNA-Histidine Guanylyltransferase 1-Like (THG1L))

Autre désignation: THG1L

Sujet: THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.

Poids moléculaire: 35 kDa (MW of target protein)