DCAF12 anticorps (Middle Region)

N° du produit ABIN632109

Cet anticorps anti-DCAF12 Polyclonal Lapin (ABIN632109) détecte spécifiquement DCAF12 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DCAF12 anticorps (Middle Region) (ABIN632109)

Antigène: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCAF12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DCAF12 anticorps

Épitope: Middle Region

Specificité: WDR40 A antibody was raised against the middle region of WDR40

Purification: Affinity purified

Immunogène: WDR40 A antibody was raised using the middle region of WDR40 corresponding to a region with amino acids TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR40A Blocking Peptide, (ABIN5616998), is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCAF12

Antigène: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Autre désignation: WDR40A

Sujet: This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.

Poids moléculaire: 50 kDa (MW of target protein)