SSBP3 anticorps (Middle Region)

N° du produit ABIN632119

Cet anticorps Lapin Polyclonal détecte spécifiquement SSBP3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SSBP3 anticorps (Middle Region) (ABIN632119)

Antigène: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SSBP3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SSBP3 anticorps

Épitope: Middle Region

Specificité: SSBP3 antibody was raised against the middle region of SSBP3

Purification: Affinity purified

Immunogène: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SSBP3 Blocking Peptide, (ABIN937376), is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SSBP3

Antigène: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Autre désignation: SSBP3

Sujet: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Poids moléculaire: 38 kDa (MW of target protein)