PGM2L1 anticorps (N-Term)

N° du produit ABIN632120

L’anticorps Lapin Polyclonal anti-PGM2L1 a été validé pour WB. Il convient pour détecter PGM2L1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PGM2L1 anticorps (N-Term) (ABIN632120)

Antigène: PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGM2L1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PGM2L1 anticorps

Épitope: N-Term

Specificité: PGM2 L1 antibody was raised against the N terminal of PGM2 1

Purification: Affinity purified

Immunogène: PGM2 L1 antibody was raised using the N terminal of PGM2 1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGM2L1 Blocking Peptide, (ABIN939707), is also available for use as a blocking control in assays to test for specificity of this PGM2L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGM2L1

Antigène: PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))

Autre désignation: PGM2L1

Sujet: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.

Poids moléculaire: 70 kDa (MW of target protein)